Recombinant Human tumor protein p53 binding protein 1 Protein, His tagged
Cat.No. : | TP53BP1-001H |
Product Overview : | Recombinant Human TP53BP1 Protein (1614-1972aa) with His tag was expressed in CHO. |
Availability | April 18, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | CHO |
Tag : | His |
Protein Length : | 1614-1972aa |
Description : | This gene encodes a protein that functions in the DNA double-strand break repair pathway choice, promoting non-homologous end joining (NHEJ) pathways, and limiting homologous recombination. This protein plays multiple roles in the DNA damage response, including promoting checkpoint signaling following DNA damage, acting as a scaffold for recruitment of DNA damage response proteins to damaged chromatin, and promoting NHEJ pathways by limiting end resection following a double-strand break. These roles are also important during V(D)J recombination, class switch recombination and at unprotected telomeres. Alternative splicing results in multiple transcript variants encoding different isoforms. |
Tag : | C-His |
Molecular Mass : | 40.66 kDa |
AA Sequence : | AADISLDNLVEGKRKRRSNVSSPATPTASSSSSTTPTRKITESPRASMGVLSGKRKLITSEEERSPAKRGRKSATVKPGAVGAGEFVSPCESGDNTGEPSALEEQRGPLPLNKTLFLGYAFLLTMATTSDKLASRSKLPDGPTGSSEEEEEFLEIPPFNKQYTESQLRAGAGYILEDFNEAQCNTAYQCLLIADQHCRTRKYFLCLASGIPCVSHVWVHDSCHANQLQNYRNYLLPAGYSLEEQRILDWQPRENPFQNLKVLLVSDQQQNFLELWSEILMTGGAASVKQHHSSAHNKDIALGVFDVVVTDPSCPASVLKCAEALQLPVVSQEWVIQCLIVGERIGFKQHPKYKHDYVSHHHHHHHHH |
Endotoxin : | < 1 EU/μg by LAL |
Purity : | > 70% by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Sterile PBS, pH7.4 |
Concentration : | 1.0 mg/mL by BCA |
Gene Name | TP53BP1 tumor protein p53 binding protein 1 [ Homo sapiens (human) ] |
Official Symbol | TP53BP1 |
Synonyms | TP53BP1; tumor protein p53 binding protein 1; tumor protein p53 binding protein, 1; tumor suppressor p53-binding protein 1; 53BP1; p202; p53BP1; p53-binding protein 1; tumor protein 53-binding protein, 1; tumor protein p53-binding protein, 1; FLJ41424; MGC138366 |
Gene ID | 7158 |
mRNA Refseq | NM_001141979 |
Protein Refseq | NP_001135451 |
MIM | 605230 |
UniProt ID | Q12888 |
◆ Recombinant Proteins | ||
TP53BP1-5029Z | Recombinant Zebrafish TP53BP1 | +Inquiry |
TP53BP1-2839H | Recombinant Human Phosphorylated TP53BP1 Protein, His-tagged | +Inquiry |
TP53BP1-26025TH | Recombinant Human TP53BP1, His-tagged | +Inquiry |
TP53BP1-5803H | Recombinant Human TP53BP1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
TP53BP1-15H | Recombinant Human TP53BP1, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TP53BP1 Products
Required fields are marked with *
My Review for All TP53BP1 Products
Required fields are marked with *
0
Inquiry Basket