Recombinant Human TULP1 protein(131-310 aa), C-His-tagged

• Cat.No.: TULP1-2453H
• Product Overview: Recombinant Human TULP1 protein(O00294)(131-310 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• ProteinLength: 131-310 aa
• Form: 0.15 M Phosphate buffered saline
• AASequence: EAEEKKEKILLPPKKPLREKSSADLKERRAKAQGPRGDLGSPDPPPKPLRVRNKEAPAGEGTKMRKTKKKGSGEADKDPSGSPASARKSPAAMFLVGEGSPDKKALKKKGTPKGARKEEEEEEEAATVIKKSNQKGKAKGKGKKKAKEERAPSPPVEVDEPREFVLRPAPQGRTVRCRLT
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: TULP1 tubby like protein 1 [ Homo sapiens ]
• Official Symbol: TULP1
• Synonyms: TULP1; tub; RP14; tubby-related protein 1; TUBL1; LCA15
• Gene ID: 7287
• mRNA Refseq: NM_003322
• Protein Refseq: NP_003313
• MIM: 602280
• UniProt ID: O00294