Recombinant Human TUBGCP3 protein, His-tagged
Cat.No. : | TUBGCP3-3843H |
Product Overview : | Recombinant Human TUBGCP3 protein(1-350 aa), fused to His tag, was expressed in E. coli. |
Availability | April 20, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-350 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MATPDQKSPNVLLQNLCCRILGRSEADVAQQFQYAVRVIGSNFAPTVERDEFLVAEKIKKELIRQRREADAALFSELHRKLHSQGVLKNKWSILYLLLSLSEDPRRQPSKVSSYATLFAQALPRDAHSTPYYYARPQTLPLSYQDRSAQSAQSSGSVGSSGISSIGLCALSGPAPAPQSLLPGQSNQAPGVGDCLRQQLGSRLAWTLTANQPSSQATTSKGVPSAVSRNMTRSRREGDTGGTMEITEAALVRDILYVFQGIDGKNIKMNNTENCYKVEGKANLSRSLRDTAVRLSELGWLHNKIRRYTDQRSLDRSFGLVGQSFCAALHQELREYYRLLSVLHSQLQLED |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | TUBGCP3 tubulin, gamma complex associated protein 3 [ Homo sapiens ] |
Official Symbol | TUBGCP3 |
Synonyms | TUBGCP3; tubulin, gamma complex associated protein 3; gamma-tubulin complex component 3; GCP3; SPBC98; Spc98p; spindle pole body protein; GCP-3; h104p; hGCP3; hSpc98; hGrip104; gamma-ring complex protein 104 kDa; spindle pole body protein Spc98 homolog; |
Gene ID | 10426 |
mRNA Refseq | NM_006322 |
Protein Refseq | NP_006313 |
UniProt ID | Q96CW5 |
◆ Recombinant Proteins | ||
TUBGCP3-17627M | Recombinant Mouse TUBGCP3 Protein | +Inquiry |
TUBGCP3-6241H | Recombinant Human TUBGCP3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
TUBGCP3-1250Z | Recombinant Zebrafish TUBGCP3 | +Inquiry |
TUBGCP3-3843H | Recombinant Human TUBGCP3 protein, His-tagged | +Inquiry |
TUBGCP3-9057HFL | Recombinant Full Length Human TUBGCP3 protein, Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TUBGCP3-641HCL | Recombinant Human TUBGCP3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TUBGCP3 Products
Required fields are marked with *
My Review for All TUBGCP3 Products
Required fields are marked with *
0
Inquiry Basket