Recombinant Human TUBB4A protein, His-tagged
Cat.No. : | TUBB4A-3635H |
Product Overview : | Recombinant Human TUBB4A protein(P04350)(1-444aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-444aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 53.6 kDa |
AA Sequence : | MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLERINVYYNEATGGNYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDAVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEFPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLSVQSKNSSYFVEWIPNNVKTAVCDIPPRGLKMAATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAEEGEFEEEAEEEVA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | TUBB4A tubulin, beta 4A class IVa [ Homo sapiens ] |
Official Symbol | TUBB4A |
Synonyms | TUBB4A; tubulin, beta 4A class IVa; TUBB4, tubulin, beta 4 , tubulin, beta 4 class IVa; tubulin beta-4A chain; beta 5; class IVa beta tubulin; tubulin 5 beta; tubulin, beta, 5; tubulin beta-4 chain; class IVa beta-tubulin; tubulin, beta 4 class IVa; TUBB4; TUBB5; beta-5; |
Gene ID | 10382 |
mRNA Refseq | NM_006087 |
Protein Refseq | NP_006078 |
MIM | 602662 |
UniProt ID | P04350 |
◆ Recombinant Proteins | ||
TUBB4A-1942H | Recombinant Human TUBB4A Protein (1-444 aa), His-tagged | +Inquiry |
TUBB4A-807C | Recombinant Cynomolgus Monkey TUBB4A Protein, His (Fc)-Avi-tagged | +Inquiry |
TUBB4A-17619M | Recombinant Mouse TUBB4A Protein | +Inquiry |
TUBB4A-2278H | Recombinant Human TUBB4A Protein, His (Fc)-Avi-tagged | +Inquiry |
TUBB4A-564H | Recombinant Human TUBB4A Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TUBB4A-647HCL | Recombinant Human TUBB4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TUBB4A Products
Required fields are marked with *
My Review for All TUBB4A Products
Required fields are marked with *
0
Inquiry Basket