Recombinant Human TUBB protein(11-440 aa), C-His-tagged

Cat.No. : TUBB-2585H
Product Overview : Recombinant Human TUBB protein(P07437)(11-440 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Source : E. coli
Species : Human
Tag : His
Protein length : 11-440 aa
Form : 0.15 M Phosphate buffered saline
AASequence : MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLDRISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQVFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAEEEEDFGEEAEE
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
Gene Name TUBB tubulin, beta class I [ Homo sapiens ]
Official Symbol TUBB
Synonyms TUBB; tubulin, beta class I; tubulin, beta , tubulin, beta polypeptide; tubulin beta chain; beta1 tubulin; class I beta tubulin; M40; MGC16435; OK/SW cl.56; Tubb5; beta1-tubulin; beta 5-tubulin; beta-4 tubulin; beta Ib tubulin; class I beta-tubulin; tubulin beta-1 chain; tubulin beta-5 chain; tubulin beta polypeptide; tubulin, beta polypeptide; TUBB1; TUBB5; OK/SW-cl.56; MGC117247;
Gene ID 203068
mRNA Refseq NM_178014
Protein Refseq NP_821133
MIM 191130
UniProt ID P07437

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All TUBB Products

Required fields are marked with *

My Review for All TUBB Products

Required fields are marked with *

0

Inquiry Basket

cartIcon