Recombinant Human TUBA3FP Protein, GST-tagged
Cat.No. : | TUBA3FP-4346H |
Product Overview : | Human MGC16703 full-length ORF ( NP_659479.2, 1 a.a. - 154 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | TUBA3FP (Tubulin Alpha 3f Pseudogene) is a Pseudogene. |
Molecular Mass : | 43.1 kDa |
AA Sequence : | MQLSGNGLEEQAAQHLDELLLAHTDLKSLDLSYNQLNDQADLCMGLQGFLIFHSFGGGTGSGFVSLLMKRLSVDYGKKSKLEFAICPAPQVSMAMTEPYNSILTTYTTLEHSDCAFIVNSKATYDMSAQPGHRVSHVHQPQSSGQIVSSITASL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | TUBA3FP tubulin alpha 3f pseudogene [ Homo sapiens (human) ] |
Official Symbol | TUBA3FP |
Synonyms | TUBA3FP; tubulin alpha 3f pseudogene; tubulin, alpha pseudogene |
Gene ID | 113691 |
◆ Recombinant Proteins | ||
TUBA3FP-1241H | Recombinant Human MGC16703 Protein, His-tagged | +Inquiry |
TUBA3FP-6151HF | Recombinant Full Length Human TUBA3FP Protein, GST-tagged | +Inquiry |
TUBA3FP-4346H | Recombinant Human TUBA3FP Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TUBA3FP-1089HCL | Recombinant Human TUBA3FP cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TUBA3FP Products
Required fields are marked with *
My Review for All TUBA3FP Products
Required fields are marked with *
0
Inquiry Basket