Recombinant Human TUBA3FP Protein, GST-tagged

• Cat.No.: TUBA3FP-4346H
• Product Overview: Human MGC16703 full-length ORF ( NP_659479.2, 1 a.a. - 154 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: TUBA3FP (Tubulin Alpha 3f Pseudogene) is a Pseudogene.
• Molecular Mass: 43.1 kDa
• AA Sequence: MQLSGNGLEEQAAQHLDELLLAHTDLKSLDLSYNQLNDQADLCMGLQGFLIFHSFGGGTGSGFVSLLMKRLSVDYGKKSKLEFAICPAPQVSMAMTEPYNSILTTYTTLEHSDCAFIVNSKATYDMSAQPGHRVSHVHQPQSSGQIVSSITASL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: TUBA3FP tubulin alpha 3f pseudogene [ Homo sapiens (human) ]
• Official Symbol: TUBA3FP
• Synonyms: TUBA3FP; tubulin alpha 3f pseudogene; tubulin, alpha pseudogene
• Gene ID: 113691