Recombinant Human TTLL4 Protein, his-tagged

• Cat.No.: TTLL4-3480H
• Product Overview: Recombinant Human TTLL4 Protein (601-955 aa) is produced by E. coli-derived, PET28a expression system. This protein is fused with a His tag.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 601-955 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization.
• Molecular Mass: 41 kDa
• AA Sequence: WEQRKLLRWKMSTVTPNIVKQTIGRSHFKISKRNDDWLGCWGHHMKSPSFRSIREHQKLNHFPGSFQIGRKDRLWRNLSRMQSRFGKKEFSFFPQSFILPQDAKLLRKAWESSSRQKWIVKPPASARGIGIQVIHKWSQLPKRRPLLVQRYLHKPYLISGSKFDLRIYVYVTSYDPLRIYLFSDGLVRFASCKYSPSMKSLGNKFMHLTNYSVNKKNAEYQANADEMACQGHKWALKALWNYLSQKGVNSDSIWEKIKDVVVKTIISSEPYVTSLLKMYVRRPYSCHELFGFDIMLDENLKPWVLEVNISPSLHSSSPLDISIKGQMIRDLLNLAGFVLPNAEDIISSPSSCSSS
• Purity: > 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Notes: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution.
• Stability: Store for up to 12 months at -20 centigrade to -80 centigrade as lyophilized powder.
• Storage: Short-term storage: Store at 2-8 centigrade for (1-2 weeks).
  Long-term storage: Aliquot and store at -20 centigrade to -80 centigrade for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details).
  If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used).
• Shipping: The product is shipped at ambient temperature. Upon receipt, store it immediately at the recommended temperature.

Gene Information

• Gene Name: TTLL4 tubulin tyrosine ligase-like family, member 4 [ Homo sapiens ]
• Official Symbol: TTLL4
• Synonyms: TTLL4; tubulin polyglutamylase TTLL4; tubulin tyrosine ligase-like family, member 4; tubulin--tyrosine ligase-like protein 4
• Gene ID: 9654
• mRNA Refseq: NM_014640.4
• Protein Refseq: NP_055455.3
• UniProt ID: Q14679