Recombinant Human TTC9C Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: TTC9C-1417H
• Product Overview: TTC9C MS Standard C13 and N15-labeled recombinant protein (NP_776171) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: TTC9C (Tetratricopeptide Repeat Domain 9C) is a Protein Coding gene. An important paralog of this gene is TTC9.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 20 kDa
• AA Sequence: MEKRLQEAQLYKEEGNQRYREGKYRDAVSRYHRALLQLRGLDPSLPSPLPNLGPQGPALTPEQENILHTTQTDCYNNLAACLLQMEPVNYERVREYSQKVLERQPDNAKALYRAGVAFFHLQDYDQARHYLLAAVNRQPKDANVRRYLQLTQSELSSYHRKEKQLYLGMFGTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: TTC9C tetratricopeptide repeat domain 9C [ Homo sapiens (human) ]
• Official Symbol: TTC9C
• Synonyms: TTC9C; tetratricopeptide repeat domain 9C; tetratricopeptide repeat protein 9C; MGC29649; TPR repeat protein 9C
• Gene ID: 283237
• mRNA Refseq: NM_173810
• Protein Refseq: NP_776171
• UniProt ID: Q8N5M4