Recombinant Human TTC9C Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | TTC9C-1417H |
Product Overview : | TTC9C MS Standard C13 and N15-labeled recombinant protein (NP_776171) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | TTC9C (Tetratricopeptide Repeat Domain 9C) is a Protein Coding gene. An important paralog of this gene is TTC9. |
Molecular Mass : | 20 kDa |
AA Sequence : | MEKRLQEAQLYKEEGNQRYREGKYRDAVSRYHRALLQLRGLDPSLPSPLPNLGPQGPALTPEQENILHTTQTDCYNNLAACLLQMEPVNYERVREYSQKVLERQPDNAKALYRAGVAFFHLQDYDQARHYLLAAVNRQPKDANVRRYLQLTQSELSSYHRKEKQLYLGMFGTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | TTC9C tetratricopeptide repeat domain 9C [ Homo sapiens (human) ] |
Official Symbol | TTC9C |
Synonyms | TTC9C; tetratricopeptide repeat domain 9C; tetratricopeptide repeat protein 9C; MGC29649; TPR repeat protein 9C; |
Gene ID | 283237 |
mRNA Refseq | NM_173810 |
Protein Refseq | NP_776171 |
UniProt ID | Q8N5M4 |
◆ Recombinant Proteins | ||
TTC9C-1058C | Recombinant Cynomolgus TTC9C Protein, His-tagged | +Inquiry |
TTC9C-1417H | Recombinant Human TTC9C Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Ttc9c-6718M | Recombinant Mouse Ttc9c Protein, Myc/DDK-tagged | +Inquiry |
TTC9C-801C | Recombinant Cynomolgus Monkey TTC9C Protein, His (Fc)-Avi-tagged | +Inquiry |
TTC9C-10603Z | Recombinant Zebrafish TTC9C | +Inquiry |
◆ Cell & Tissue Lysates | ||
TTC9C-672HCL | Recombinant Human TTC9C 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TTC9C Products
Required fields are marked with *
My Review for All TTC9C Products
Required fields are marked with *
0
Inquiry Basket