Recombinant Human TTC4 protein, T7-tagged
Cat.No. : | TTC4-164H |
Product Overview : | Recombinant human TTC4 fused with T7 Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | T7 |
Form : | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
AA Sequence : | MASMTGGQQMGRGEFEQPGQDPTSDDVMDSFLEKFQSQPYRGGFHEDQWEKEFEKVPLFMSRAPSEIDPRENPDL ACLQSIIFDEERSPEEQAKTYKDEGNDYFKEKDYKKAVISYTEGLKKKCADPDLNAVLYTNRAAAQYYLGNFRSA LNDVTAARKLKPCHLKAIIRGALCHLELKHFAEAVNWCDEGLQIDAKEKKLLEMRAKADKLKRIEQRDVRKANLK EKKERNQNEALLQAIKARNIRLSEAACEDEDSASEGLGELFLDGLSTENPHGARLSLDGQGRLSWPVLFLYPEYA QSDFISAFHEDSRFIDHLMVMFGETPSWDLEQKYCPDNLEVYFEDEDRAELYRVPAKSTLLQVLQHQRYFVKALT PAFLVCVGSSPFCKNFLRGRKVYQIR |
Purity : | >90% by SDS-PAGE |
Applications : | 1. May be used for human TTC4 protein functional study in vitro.2. May be used for in vitro protein-protein interaction measurement for mapping TTC4 binder.3. May be used as antigen for specific antibody production. |
Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days. |
Gene Name | TTC4 tetratricopeptide repeat domain 4 [ Homo sapiens ] |
Official Symbol | TTC4 |
Synonyms | TTC4; tetratricopeptide repeat domain 4; tetratricopeptide repeat protein 4; FLJ41930; MGC5097; TPR repeat protein 4; DKFZp781B0622; |
Gene ID | 7268 |
mRNA Refseq | NM_004623 |
Protein Refseq | NP_004614 |
MIM | 606753 |
UniProt ID | O95801 |
Chromosome Location | 1p32 |
Function | binding; |
◆ Recombinant Proteins | ||
TTC4-4831R | Recombinant Rhesus Macaque TTC4 Protein, His (Fc)-Avi-tagged | +Inquiry |
TTC4-5017R | Recombinant Rhesus monkey TTC4 Protein, His-tagged | +Inquiry |
TTC4-11239Z | Recombinant Zebrafish TTC4 | +Inquiry |
TTC4-164H | Recombinant Human TTC4 protein, T7-tagged | +Inquiry |
TTC4-349Z | Recombinant Zebrafish TTC4 | +Inquiry |
◆ Cell & Tissue Lysates | ||
TTC4-674HCL | Recombinant Human TTC4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TTC4 Products
Required fields are marked with *
My Review for All TTC4 Products
Required fields are marked with *
0
Inquiry Basket