Recombinant Human TTC32 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : TTC32-4253H
Product Overview : TTC32 MS Standard C13 and N15-labeled recombinant protein (NP_001008238) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : TTC32 (Tetratricopeptide Repeat Domain 32) is a Protein Coding gene. Gene Ontology (GO) annotations related to this gene include identical protein binding. An important paralog of this gene is SPAG1.
Molecular Mass : 17.3 kDa
AA Sequence : MEGQRQESHATLTLAQAHFNNGEYAEAEALYSAYIRRCACAASSDESPGSKCSPEDLATAYNNRGQIKYFRVDFYEAMDDYTSAIEVQPNFEVPYYNRGLILYRLGYFDDALEDFKKVLDLNPGFQDATLSLKQTILDKEEKQRRNVAKNYTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name TTC32 tetratricopeptide repeat domain 32 [ Homo sapiens (human) ]
Official Symbol TTC32
Synonyms TTC32; tetratricopeptide repeat domain 32; tetratricopeptide repeat protein 32; TPR repeat protein 32;
Gene ID 130502
mRNA Refseq NM_001008237
Protein Refseq NP_001008238
UniProt ID Q5I0X7

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All TTC32 Products

Required fields are marked with *

My Review for All TTC32 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon