Recombinant Human TTC3, His-tagged
Cat.No. : | TTC3-31249TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 1870-2025 of Human TTC3 with N terminal His tag; Predicted MWt 18 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | 1870-2025 a.a. |
Description : | Tetratricopeptide repeat protein 3 is a protein that in humans is encoded by the TTC3 gene. |
Conjugation : | HIS |
Tissue specificity : | Found in all tissues examined. |
Form : | Lyophilised:Reconstitute with 77 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | VRSKNKNSLSGLSIDEIVQRVTEHILDEQKKKKPNPGKDK RTYEPSSATPVTRSSQGSPSVVVAPSPKTKGQKAEDVP VRIALGASSCEICHEVFKSKNVRVLKCGHKYHKGCFKQ WLKGQSACPACQGRDLLTEESPSGRGWPSQNQELPSCS SR |
Sequence Similarities : | Contains 1 RING-type zinc finger.Contains 4 TPR repeats. |
Gene Name | TTC3 tetratricopeptide repeat domain 3 [ Homo sapiens ] |
Official Symbol | TTC3 |
Synonyms | TTC3; tetratricopeptide repeat domain 3; E3 ubiquitin-protein ligase TTC3; DCRR1; RNF105; TPRD; TPRDI; TPRDII; TPRDIII; |
Gene ID | 7267 |
mRNA Refseq | NM_003316 |
Protein Refseq | NP_003307 |
MIM | 602259 |
Uniprot ID | P53804 |
Chromosome Location | 21q22.2 |
Function | ligase activity; metal ion binding; protein binding; ubiquitin-protein ligase activity; zinc ion binding; |
◆ Recombinant Proteins | ||
FAM193B-3729H | Recombinant Human FAM193B Protein, GST-tagged | +Inquiry |
FLT3LG-275H | Active Recombinant Human Fms-related Tyrosine Kinase 3 Ligand, MIgG2a Fc-tagged | +Inquiry |
ECHDC3-2624M | Recombinant Mouse ECHDC3 Protein, His (Fc)-Avi-tagged | +Inquiry |
ST6GALNAC3-1707H | Recombinant Human ST6GALNAC3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Cr2-5002M | Recombinant Mouse Cr2 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
BPI-72H | Native Human Bacterial/Permeability-Increasing Protein | +Inquiry |
Hp-134M | Native Mouse Haptoglobin | +Inquiry |
MBP-89S | Native Swine MBP Protein | +Inquiry |
ELANE-8104H | Native Human Neutrophil Elastase | +Inquiry |
Bcl2a1b-5322M | Native Mouse B-Cell Leukemia/Lymphoma 2 Related Protein A1b | +Inquiry |
◆ Cell & Tissue Lysates | ||
DHDH-468HCL | Recombinant Human DHDH cell lysate | +Inquiry |
CD37-7677HCL | Recombinant Human CD37 293 Cell Lysate | +Inquiry |
MTF1-4085HCL | Recombinant Human MTF1 293 Cell Lysate | +Inquiry |
FAM118B-6445HCL | Recombinant Human FAM118B 293 Cell Lysate | +Inquiry |
Cerebellar Peduncles-63H | Human Cerebellar Peduncles Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TTC3 Products
Required fields are marked with *
My Review for All TTC3 Products
Required fields are marked with *
0
Inquiry Basket