Recombinant Human TSPAN7 protein

• Cat.No.: TSPAN7-237H
• Product Overview: Recombinant Human TSPAN7 was expressed in Wheat Germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Description: The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein and may have a role in the control of neurite outgrowth. It is known to complex with integrins. This gene is associated with X-linked mental retardation and neuropsychiatric diseases such as Huntington's chorea, fragile X syndrome and myotonic dystrophy.
• Form: 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
• Molecular Mass: 27.6 kDa
• AA Sequence: MASRRMETKPVITCLKTLLIIYSFVFWITGVILLAVGVWGKLTLGTYISLIAENSTNAPYVLIGTGTTIVVFGLF GCFATCRGSPWMLKLYAMFLSLVFLAELVAGISGFVFRHEIKDTFLRTYTDAMQTYNGNDERSRAVDHVQRSLSC CGVQNYTNWSTSPYFLEHGIPPSCCMNETDCNPQDLHNLTVAATKVNQKGCYDLVTSFMETNMGIIAGVAFGIAF SQLIGMLLACCLSRFITANQYEMV
• Purity: > 95 % by SDS-PAGE.
• Applications: Antibody Production; Functional Study(Recommended usage only, not validated yet); Compound Screening(Recommended usage only, not validated yet).
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: TSPAN7 tetraspanin 7 [ Homo sapiens ]
• Official Symbol: TSPAN7
• Synonyms: TSPAN7; tetraspanin 7; mental retardation, X linked 58 , MRX58, MXS1, TM4SF2, transmembrane 4 superfamily member 2; tetraspanin-7; A15; CD231; DXS1692E; TALLA 1; tspan-7; CD231 antigen; tetraspanin protein; transmembrane protein A15; cell surface glycoprotein A15; transmembrane 4 superfamily 2b; transmembrane 4 superfamily member 2; membrane component chromosome X surface marker 1; membrane component, X chromosome, surface marker 1; T-cell acute lymphoblastic leukemia associated antigen 1; T-cell acute lymphoblastic leukemia-associated antigen 1; MXS1; MRX58; CCG-B7; TM4SF2; TALLA-1; TM4SF2b
• Gene ID: 7102
• mRNA Refseq: NM_004615
• Protein Refseq: NP_004606
• MIM: 300096
• UniProt ID: P41732
• Chromosome Location: Xp11.4
• Pathway: Transcriptional misregulation in cancer, organism-specific biosystem; Transcriptional misregulation in cancer, conserved biosystem