Recombinant Human TSPAN7 Protein (113-213 aa), His-tagged

• Cat.No.: TSPAN7-843H
• Product Overview: Recombinant Human TSPAN7 Protein (113-213 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Immunology. Protein Description: Partial.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 113-213 aa
• Description: May be involved in cell proliferation and cell motility.
• Form: Tris-based buffer, 50% glycerol
• Molecular Mass: 15.6 kDa
• AA Sequence: RHEIKDTFLRTYTDAMQTYNGNDERSRAVDHVQRSLSCCGVQNYTNWSTSPYFLEHGIPPSCCMNETDCNPQDLHNLTVAATKVNQKGCYDLVTSFMETNM
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with concentration instruction is sent along with the products.

Gene Information

• Gene Name: TSPAN7 tetraspanin 7 [ Homo sapiens ]
• Official Symbol: TSPAN7
• Synonyms: TSPAN7; A15; CD231; DXS1692E; TALLA 1; tspan-7; CD231 antigen; MXS1; MRX58; CCG-B7; TM4SF2; TALLA-1; TM4SF2b
• Gene ID: 7102
• mRNA Refseq: NM_004615
• Protein Refseq: NP_004606
• MIM: 300096
• UniProt ID: P41732