Recombinant Human TSGA14 protein, His-tagged
Cat.No. : | TSGA14-2495H |
Product Overview : | Recombinant Human TSGA14 protein(1-301 aa), fused to His tag, was expressed in E. coli. |
Availability | February 08, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | 1-301 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MSLRRHIGNPEYLMKRIPQNPRYQHIKSRLDTGNSMTKYTEKLEEIKKNYRYKKDELFKRLKVTTFAQLIIQVASLSDQTLEVTAEEIQRLEDNDSAASDPDAETTARTNGKGNPGEQSPSPEQFINNAGAGDSSRSTLQSVISGVGELDLDKGPVKKAEPHTKDKPYPDCPFLLLDVRDRDSYQQCHIVGAYSYPIATLSRTMNPYSNDILEYKNAHGKIIILYDDDERLASQAATTMCERGFENLFMLSGGRLNQANSSGRESKVPGARSAQNLPGGGPASHSNPRSLSSGHLQGKPWK |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | CEP41 centrosomal protein 41kDa [ Homo sapiens ] |
Official Symbol | TSGA14 |
Synonyms | JBTS15; TSGA14 |
Gene ID | 95681 |
mRNA Refseq | NM_001257158 |
Protein Refseq | NP_001244087 |
MIM | 610523 |
UniProt ID | Q9BYV8 |
◆ Recombinant Proteins | ||
PARP1-451H | Active Recombinant Human PARP1, HA-tagged | +Inquiry |
CD226-5428H | Recombinant Human CD226 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
BLOC1S5-991R | Recombinant Rat BLOC1S5 Protein | +Inquiry |
CDK1-1533H | Recombinant Human CDK1, Unactive, GST-tagged | +Inquiry |
Acyp1-3145M | Recombinant Mouse Acyp1, GST-tagged | +Inquiry |
◆ Native Proteins | ||
Fgg -65R | Native Rat Fibrinogen, FITC Labeled | +Inquiry |
FGG -32B | Native Bovine Fibrinogen | +Inquiry |
LDHA-8315C | Native Chicken LDHA | +Inquiry |
IgG-011H | Native Human Whole Molecule IgG, Biotin-LC-NHS Conjugated | +Inquiry |
Complement C4-50H | Native Human Complement C4 | +Inquiry |
◆ Cell & Tissue Lysates | ||
NAALADL1-2589HCL | Recombinant Human NAALADL1 cell lysate | +Inquiry |
REG1A-1364RCL | Recombinant Rat REG1A cell lysate | +Inquiry |
TRPV4-730HCL | Recombinant Human TRPV4 293 Cell Lysate | +Inquiry |
ABCF1-7HCL | Recombinant Human ABCF1 cell lysate | +Inquiry |
Rgr-1498HCL | Recombinant Human Rgr cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All TSGA14 Products
Required fields are marked with *
My Review for All TSGA14 Products
Required fields are marked with *
0
Inquiry Basket