Recombinant Human TSC22D1, His-tagged

• Cat.No.: TSC22D1-30748TH
• Product Overview: Recombinant fragment, corresponding to amino acids 40-144 of Human TSC22D1 Isoform 2 with an N terminal His tag; Predicted MWt 12 kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 40-144 a.a.
• Description: This gene encodes a member of the TSC22 domain family of leucine zipper transcription factors. The encoded protein is stimulated by transforming growth factor beta, and regulates the transcription of multiple genes including C-type natriuretic peptide. The encoded protein may play a critical role in tumor suppression through the induction of cancer cell apoptosis, and a single nucleotide polymorphism in the promoter of this gene has been associated with diabetic nephropathy. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
• Conjugation: HIS
• Form: Lyophilised:Reconstitute with 139 μl aqua dest.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: DNSSSGASVVAIDNKIEQAMDLVKSHLMYAVREEVEVLKE QIKELIEKNSQLEQENNLLKTLASPEQLAQFQAQLQTG SPPATTQPQGTTQPPAQPASQGSGPTA

Gene Information

• Gene Name: TSC22D1 TSC22 domain family, member 1 [ Homo sapiens ]
• Official Symbol: TSC22D1
• Synonyms: TSC22D1; TSC22 domain family, member 1; TGFB1I4, transforming growth factor beta 1 induced transcript 4; TSC22 domain family protein 1; MGC17597; TSC22
• Gene ID: 8848
• mRNA Refseq: NM_001243798
• Protein Refseq: NP_001230727
• MIM: 607715
• Uniprot ID: Q15714
• Chromosome Location: 13q14
• Function: sequence-specific DNA binding transcription factor activity