Recombinant Human TRPM8 protein, His-tagged

• Cat.No.: TRPM8-3702H
• Product Overview: Recombinant Human TRPM8 protein(3-192 aa), fused with N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 3-192 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• Purity: 75%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.
• AA Sequence: SFLPVHTIVLIRENVCKCGYAQSQHMEGTQINQSEKWNYKKHTKEFPTDAFGDIQFETLGKKGKYIRLSCDTDAEILYELLTQHWHLKTPNLVISVTGGAKNFALKPRMRKIFSRLIYIAQSKGAWILTGGTHYGLMKYIGEVVRDNTISRSSEENIVAIGIAAWGMVSNRDTLIRNCDAEVPVGQEEVC

Gene Information

• Gene Name: TRPM8 transient receptor potential cation channel, subfamily M, member 8 [ Homo sapiens ]
• Official Symbol: TRPM8
• Synonyms: TRPM8; transient receptor potential cation channel, subfamily M, member 8; transient receptor potential cation channel subfamily M member 8; trp-p8; LTrpC-6; transient receptor potential p8; short form of the TRPM8 cationic channel; long transient receptor potential channel 6; transient receptor potential subfamily M member 8; TRPP8; LTRPC6; MGC2849
• Gene ID: 79054
• mRNA Refseq: NM_024080
• Protein Refseq: NP_076985
• MIM: 606678
• UniProt ID: Q7Z2W7