Recombinant Human TRPA1 Protein, N-GST-tagged

• Cat.No.: TRPA1-18H
• Product Overview: Human TRPA1 partial ORF ( NP_015628, 1033 a.a. - 1117 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 1033-1117 aa
• Description: The structure of the protein encoded by this gene is highly related to both the protein ankyrin and transmembrane proteins. The specific function of this protein has not yet been determined; however, studies indicate the function may involve a role in signal transduction and growth control.
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 35.09 kDa
• AA Sequence: IPNADKSLEMEILKQKYRLKDLTFLLEKQHELIKLIIQKMEIISETEDDDSHCSFQDRFKKEQMEQRNSRWNTVLRAVKAKTHHL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: TRPA1 transient receptor potential cation channel subfamily A member 1 [ Homo sapiens (human) ]
• Official Symbol: TRPA1
• Synonyms: FEPS; p120; FEPS1; ANKTM1; transient receptor potential cation channel subfamily A member 1; TRPA1
• Gene ID: 8989
• mRNA Refseq: NM_007332.3
• Protein Refseq: NP_015628.2
• MIM: 604775
• UniProt ID: O75762