Recombinant Human TRPA1 protein, His-SUMO-tagged

• Cat.No.: TRPA1-345H
• Product Overview: Recombinant Human TRPA1 protein(NP_015628)(957-1119aa), fused with two N-terminal tags, 6xHis tag and SUMO tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 957-1119aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 35.2kDa
• AA Sequence: IGLAVGDIAEVQKHASLKRIAMQVELHTSLEKKLPLWFLRKVDQKSTIVYPNKPRSGGMLFHIFCFLFCTGEIRQEIPNADKSLEMEILKQKYRLKDLTFLLEKQHELIKLIIQKMEIISETEDDDSHCSFQDRFKKEQMEQRNSRWNTVLRAVKAKTHHLEP
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Gene Information

• Gene Name: TRPA1 transient receptor potential cation channel, subfamily A, member 1 [ Homo sapiens ]
• Official Symbol: TRPA1
• Synonyms: TRPA1; transient receptor potential cation channel, subfamily A, member 1; ANKTM1, ankyrin like with transmembrane domains 1; transient receptor potential cation channel subfamily A member 1; transformation-sensitive protein p120; ankyrin-like with transmembrane domains 1; ankyrin-like with transmembrane domains protein 1; ANKTM1
• Gene ID: 8989
• mRNA Refseq: NM_007332
• Protein Refseq: NP_015628
• MIM: 604775
• UniProt ID: O75762