Recombinant Human TRIP11 protein, GST-tagged
Cat.No. : | TRIP11-830H |
Product Overview : | Recombinant Human TRIP11 protein(NP_004230)(1-68 aa), fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-68 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | AMSSWLGGLGSGLGQSLGQVGGSLASLTGQISNFTKDMLMEGTEEVEAELPDSRTKEIEAIHAILRSE |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Aliquot and store at -20°C to -80°C for up to 6 months. Avoid repeat freeze-thaw cycles. |
Concentration : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | TRIP11 thyroid hormone receptor interactor 11 [ Homo sapiens ] |
Official Symbol | TRIP11 |
Synonyms | TRIP11; thyroid hormone receptor interactor 11; thyroid receptor-interacting protein 11; CEV14; GMAP 210; Trip230; TR-interacting protein 11; Golgi-microtubule-associated protein of 210 kDa; golgi-associated microtubule-binding protein 210; clonal evolution-related gene on chromosome 14 protein; ACG1A; TRIP-11; TRIP230; GMAP-210; |
Gene ID | 9321 |
mRNA Refseq | NM_004239 |
Protein Refseq | NP_004230 |
MIM | 604505 |
UniProt ID | Q15643 |
◆ Recombinant Proteins | ||
TRIP11-8308Z | Recombinant Zebrafish TRIP11 | +Inquiry |
TRIP11-8307Z | Recombinant Zebrafish TRIP11 | +Inquiry |
TRIP11-830H | Recombinant Human TRIP11 protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TRIP11 Products
Required fields are marked with *
My Review for All TRIP11 Products
Required fields are marked with *
0
Inquiry Basket