Recombinant Human TRIML1 Protein, GST-tagged

• Cat.No.: TRIML1-4321H
• Product Overview: Human FLJ36180 full-length ORF ( AAH15684.1, 1 a.a. - 192 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: The protein encoded by this gene is a tripartite motif family protein with similarities to E3 ubiquitin-protein ligases. While the function of the encoded protein has not been determined, the orthologous protein in mouse has been shown to bind ubiquitin-specific protease 5 and is involved in the blastocyst development stage. [provided by RefSeq, Sep 2016]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 47.8 kDa
• AA Sequence: MKEMLRKFSTEITLDPATANAYLVLSEDLKSVKYGGSRQQLPDNPERFDQSATVLGTQIFTSGRHYWEVEVGNKTEWEVGICKDSVSRKGNLPKPPGDLFSLIGLKIGDDYSLWVSSPLKGQHVREPVCKVGVFLDYESGHIAFYNGTDESLIYSFPQASFQEALRPIFSPCLPNEGTNTDPLTICSLNSHV
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: TRIML1 tripartite motif family-like 1 [ Homo sapiens ]
• Official Symbol: TRIML1
• Synonyms: TRIML1; tripartite motif family-like 1; probable E3 ubiquitin-protein ligase TRIML1; FLJ36180; RNF209; RING finger protein 209; tripartite motif family-like protein 1; MGC138638; MGC138639
• Gene ID: 339976
• mRNA Refseq: NM_178556
• Protein Refseq: NP_848651
• UniProt ID: Q8N9V2