Recombinant Human TRIM47 protein partial ORF, GST-tagged

• Cat.No.: TRIM47-1401H
• Product Overview: Recombinant Human TRIM47 protein partial ORF (539a.a.-638a.a.), fused to GST-tag at N-terminus, was expressed in Wheat Germ and purified by Glutathione Sepharose 4 Fast Flow.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 100
• Description: The protein is a E3 ubiquitin-protein ligase that mediates the ubiquitination and proteasomal degradation of CYLD.
• Form: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 36.74 kDa
• AA Sequence: PLPHPFSPTVGVCLEYADRALAFYAVRDGKMSLLRRLKASRPRRGGIPASPIDPFQSRLDSHFAGLFTHRLKPAFFLESVDAHLQIGPLKKSCISVLKRR
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. Best use within three months from the date of receipt of this protein.

Gene Information

• Gene Name: TRIM47
• Official Symbol: TRIM47
• Synonyms: GOA; RNF100
• Gene ID: 91107
• mRNA Refseq: NM_033452.3
• Protein Refseq: NP_258411.2
• MIM: 611041
• UniProt ID: Q96LD4