Recombinant Human TRIM36 protein, GST-tagged

• Cat.No.: TRIM36-301290H
• Product Overview: Recombinant Human TRIM36 (166-215 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• ProteinLength: Glu166-His215
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: ESTKSCMDCSASYCNECFKIHHPWGTIKAQHEYVGPTTNFRPKILMCPEH
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: TRIM36 tripartite motif containing 36 [ Homo sapiens ]
• Official Symbol: TRIM36
• Synonyms: TRIM36; tripartite motif containing 36; E3 ubiquitin-protein ligase TRIM36; HAPRIN; RBCC728; RING finger protein 98; RNF98; tripartite motif protein 36; zinc binding protein Rbcc728; zinc-binding protein Rbcc728; tripartite motif-containing 36; tripartite motif-containing protein 36
• Gene ID: 55521
• mRNA Refseq: NM_001017397
• Protein Refseq: NP_001017397
• MIM: 609317
• UniProt ID: Q9NQ86