Recombinant Human TRIM24 Protein (891-1012 aa), His-tagged
Cat.No. : | TRIM24-1546H |
Product Overview : | Recombinant Human TRIM24 Protein (891-1012 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Epigenetics and Nuclear Signaling. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 891-1012 aa |
Description : | Transcriptional coactivator that interacts with numerous nuclear receptors and coactivators and modulates the transcription of target genes. Interacts with chromatin depending on histone H3 modifications, having the highest affinity for histone H3 that is both unmodified at 'Lys-4' (H3K4me0) and acetylated at 'Lys-23' (H3K23ac). Has E3 protein-ubiquitin ligase activity. Promotes ubiquitination and proteasomal degradation of p53/TP53. Plays a role in the regulation of cell proliferation and apoptosis, at least in part via its effects on p53/TP53 levels. Up-regulates ligand-dependent transcription activation by AR, GCR/NR3C1, thyroid hormone receptor (TR) and ESR1. Modulates transcription activation by retinoic acid (RA) receptors, including RARA. Plays a role in regulating retinoic acid-dependent proliferation of hepatocytes. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 16.5 kDa |
AA Sequence : | KKKTEGLVKLTPIDKRKCERLLLFLYCHEMSLAFQDPVPLTVPDYYKIIKNPMDLSTIKKRLQEDYSMYSKPEDFVADFRLIFQNCAEFNEPDSEVANAGIKLENYFEELLKNLYPEKRFPK |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | TRIM24 tripartite motif containing 24 [ Homo sapiens ] |
Official Symbol | TRIM24 |
Synonyms | TRIM24; hTIF1; RNF82; TIF1A; Tif1a; TIF1-alpha; PTC6; TF1A; TIF1; TIF1ALPHA; |
Gene ID | 8805 |
mRNA Refseq | NM_003852 |
Protein Refseq | NP_003843 |
MIM | 603406 |
UniProt ID | O15164 |
◆ Recombinant Proteins | ||
TRIM24-590HF | Recombinant Full Length Human TRIM24 Protein, GST-tagged | +Inquiry |
TRIM24-9596M | Recombinant Mouse TRIM24 Protein, His (Fc)-Avi-tagged | +Inquiry |
TRIM24-3409H | Recombinant Human TRIM24, His-tagged | +Inquiry |
TRIM24-858Z | Recombinant Zebrafish TRIM24 | +Inquiry |
TRIM24-223H | Recombinant Human TRIM24 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TRIM24-789HCL | Recombinant Human TRIM24 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TRIM24 Products
Required fields are marked with *
My Review for All TRIM24 Products
Required fields are marked with *
0
Inquiry Basket