Recombinant Human TRIM21, GST-tagged

Cat.No. : TRIM21-106H
Product Overview : Human TRIM21 full-length ORF (1 a.a. - 475 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The encoded protein is part of the RoSSA ribonucleoprotein, which includes a single polypeptide and one of four small RNA molecules. The RoSSA particle localizes to both the cytoplasm and the nucleus. RoSSA interacts with autoantigens in patients with Sjogren syndrome and systemic lupus erythematosus. Alternatively spliced transcript variants for this gene have been described but the full-length nature of only one has been determined.
Molecular Mass : 77.99 kDa
AA Sequence : MASAARLTMMWEEVTCPICLDPFVEPVSIECGHSFCQECISQVGKGGGSVCPVCRQRFLLKNLRPNRQLANMVNN LKEISQEAREGTQGERCAV HGERLHLFCEKDGKALCWVCAQSRKHRDHAMVPLEEAAQEYQEKLQVALGELRRK QELAEKLEVEIAIKRADWKKTVETQKSRIHAEFVQQKNF LVEEEQRQLQELEKDEREQLRILGEKEAKLAQQSQ ALQELISELDRRCHSSALELLQEVIIVLERSESWNLKDLDITSPELRSVCHVPGLKKML RTCAVHITLDPDTAN PWLILSEDRRQVRLGDTQQSIPGNEERFDSYPMVLGAQHFHSGKHYWEVDVTGKEAWDLGVCRDSVRRKGHFLLS SKSG FWTIWLWNKQKYEAGTYPQTPLHLQVPPCQVGIFLDYEAGMVSFYNITDHGSLIYSFSECAFTGPLRPFF SPGFNDGGKNTAPLTLCPLNIGSQGSTDY
Applications : ELISA; WB-Re; AP; Array
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name TRIM21 tripartite motif containing 21 [ Homo sapiens (human) ]
Official Symbol TRIM21
Synonyms TRIM21; SSA; RO52; SSA1; RNF81; tripartite motif containing 21; E3 ubiquitin-protein ligase TRIM21; SS-A; ro(SS-A); 52 kDa Ro protein; RING finger protein 81; Sicca syndrome antigen A; tripartite motif-containing 21; sjoegren syndrome type A antigen; tripartite motif-containing protein 21; 52 kDa ribonucleoprotein autoantigen Ro/SS-A; Sjogren syndrome antigen A1 (52kDa, ribonucleoprotein autoantigen SS-A/Ro)
Gene ID 6737
mRNA Refseq NM_003141
Protein Refseq NP_003132
MIM 109092
UniProt ID P19474
Chromosome Location 11p15.5
Pathway Adaptive Immune System; Antigen processing: Ubiquitination & Proteasome degradation; Cytosolic sensors of pathogen-associated DNA
Function DNA binding; RNA binding; ubiquitin-protein ligase activity

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All TRIM21 Products

Required fields are marked with *

My Review for All TRIM21 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon