Recombinant Human TRIB3 protein, GST-tagged

• Cat.No.: TRIB3-301436H
• Product Overview: Recombinant Human TRIB3 (1-144 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: Met1-Met144
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization
• AA Sequence: MRATPLAAPAGSLSRKKRLELDDNLDTERPVQKRARSGPQPRLPPCLLPLSPPTAPDRATAVATASRLGPYVLLEPEEGGRAYRALHCPTGTEYTCKVYPVQEALAVLEPYARLPPHKHVARPTEVLAGTQLLYAFFTRTHGDM
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: TRIB3 tribbles homolog 3 (Drosophila) [ Homo sapiens ]
• Official Symbol: TRIB3
• Synonyms: TRIB3; tribbles homolog 3 (Drosophila); C20orf97, chromosome 20 open reading frame 97; tribbles homolog 3; dJ1103G7.3; TRB3; TRB-3; p65-interacting inhibitor of NF-kappaB; p65-interacting inhibitor of NF-kappa-B; neuronal cell death inducible putative kinase; neuronal cell death-inducible putative kinase; NIPK; SINK; SKIP3; C20orf97
• Gene ID: 57761
• mRNA Refseq: NM_021158
• Protein Refseq: NP_066981
• MIM: 607898
• UniProt ID: Q96RU7