Recombinant Human TRAPPC2 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: TRAPPC2-3272H
• Product Overview: TRAPPC2 MS Standard C13 and N15-labeled recombinant protein (NP_001011658) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: The protein encoded by this gene is thought to be part of a large multi-subunit complex involved in the targeting and fusion of endoplasmic reticulum-to-Golgi transport vesicles with their acceptor compartment. In addition, the encoded protein can bind c-myc promoter-binding protein 1 and block its transcriptional repression capability. Mutations in this gene are a cause of spondyloepiphyseal dysplasia tarda (SEDT). A processed pseudogene of this gene is located on chromosome 19, and other pseudogenes are found on chromosomes 8 and Y. Alternatively spliced transcript variants have been found for this gene.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 16.4 kDa
• AA Sequence: MSGSFYFVIVGHHDNPVFEMEFLPAGKAESKDDHRHLNQFIAHAALDLVDENMWLSNNMYLKTVDKFNEWFVSAFVTAGHMRFIMLHDIRQEDGIKNFFTDVYDLYIKFSMNPFYEPNSPIRSSAFDRKVQFLGKKHLLSTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: TRAPPC2 trafficking protein particle complex 2 [ Homo sapiens (human) ]
• Official Symbol: TRAPPC2
• Synonyms: TRAPPC2; trafficking protein particle complex 2; SEDL, spondyloepiphyseal dysplasia, late; trafficking protein particle complex subunit 2; hYP38334; MIP 2A; SEDT; TRS20; ZNF547L; sedlin; SEDL; MIP2A; TRAPPC2P1
• Gene ID: 6399
• mRNA Refseq: NM_001011658
• Protein Refseq: NP_001011658
• MIM: 300202
• UniProt ID: P0DI81