Recombinant Human Transforming Growth Factor, Beta 2, His-tagged

• Cat.No.: TGFB2-633H
• Product Overview: Recombinant human TGFB2, fused to His tag at N-terminus, was expressed in Nicotiana benthamiana and purified by using conventional chromatography techniques.

Specification

• Species: Human
• Source: Human
• Tag: His
• Description: The three mammalian isoforms of TGF beta, TGF beta1, beta2, beta3, signal through the same receptor and elicit similar biological responses. They are multifunctional cytokines that regulate cell proliferation, growth, differentiation and motility as well as synthesis and deposition of the extracellular matrix. They are involved in various physiological processes including embryogenesis, tissue remodeling and wound healing. They are secreted predominantly as latent complexes which are stored at the cell surface and in the extracellular matrix. The release of biologically active TGF beta isoform from a latent complex involves proteolytic processing of the complex and /or induction of conformational changes by proteins such as thrombospondin-1.
• Concentration: 50 ng/ul
• Form: Lyophilized from 50mM Tris HCl at pH 7.4.
• Method of Purification: Sequential chromatography (FPLC)
• Purity: >97 % by SDS - PAGE gel
• Sequence: HHHHHHALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS
• Molecular Mass: 13.5 kDa single chain containing 118 amino residues
• Applications: Numerous applications are possible with this product and should be tested by the end user under their own laboratory conditions
• Contaminants: Free from animal matter
• Endotoxin Levels: <0.04 EU/ug protein (LAL method)
• Storage: Aliquot and store at -20 deg C. Avoid repeated freeze/thaw Cycles

Gene Information

• Gene Name: TGFB2 transforming growth factor, beta 2 [ Homo sapiens ]
• Official Symbol: TGFB2
• Synonyms: MGC116892; TGF-beta2; TGFB2; Transforming growth factor beta-2; TGF-beta-2; Glioblastoma-derived T-cell suppressor factor; G-TSF; BSC-1 cell growth inhibitor; Polyergin; Cetermin; transforming growth factor, beta 2
• Gene ID: 7042
• mRNA Refseq: NM_001135599
• Protein Refseq: NP_001129071
• MIM: 190220
• UniProt ID: P61812
• Chromosome Location: 1q41
• Pathway: ATF-2 transcription factor network; Amoebiasis; Cell cycle; Chagas disease (American trypanosomiasis); Chronic myeloid leukemia; Colorectal cancer; Cytokine-cytokine receptor interaction; Dilated cardiomyopathy; Endochondral Ossification; Endocytosis; Formation of Platelet plug; HTLV-I infection; Hemostasis; Hypertrophic cardiomyopathy (HCM); Leishmaniasis; MAPK signaling pathway; Malaria; Osteoclast differentiation; Pancreatic cancer; Platelet Activation; Platelet degranulation; Regulation of retinoblastoma protein
• Function: beta-amyloid binding; cytokine activity; growth factor activity; protein binding; contributes_to protein binding; protein heterodimerization activity; protein homodimerization activity; receptor binding; receptor signaling protein serine/threonine kinase activity; transforming growth factor beta receptor binding; type II transforming growth factor beta receptor binding