Recombinant Human TGFB2
Cat.No. : | TGFB2-31244TH |
Product Overview : | Recombinant full length protein (Human) expressed using (BTI-Tn-5B1-4) cells |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Tag : | Non |
Description : | This gene encodes a member of the transforming growth factor beta (TGFB) family of cytokines, which are multifunctional peptides that regulate proliferation, differentiation, adhesion, migration, and other functions in many cell types by transducing their signal through combinations of transmembrane type I and type II receptors (TGFBR1 and TGFBR2) and their downstream effectors, the SMAD proteins. Disruption of the TGFB/SMAD pathway has been implicated in a variety of human cancers. The encoded protein is secreted and has suppressive effects of interleukin-2 dependent T-cell growth. Translocation t(1;7)(q41;p21) between this gene and HDAC9 is associated with Peters anomaly, a congenital defect of the anterior chamber of the eye. The knockout mice lacking this gene show perinatal mortality and a wide range of developmental, including cardiac, defects. Alternatively spliced transcript variants encoding different isoforms have been identified. |
Form : | Lyophilised:Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1- 1.0 mg/ml. Do not vortex. This solution can be stored at 2-8°C for up to 1 week. For extended storage, it is recommended to further dilute in a buffer conta |
Purity : | >95% by SDS-PAGE |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | hTGF-b2 (Human Transforming Growth Factor beta 2) is a 25.0 kDa protein with each subunit containing 112 amino acid residues:ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAG ACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDL EPLTILYYIGKTPKIEQLSNMIVKSCKCS |
Sequence Similarities : | Belongs to the TGF-beta family. |
Full Length : | Full L. |
Gene Name | TGFB2 transforming growth factor, beta 2 [ Homo sapiens ] |
Official Symbol | TGFB2 |
Synonyms | TGFB2; transforming growth factor, beta 2; transforming growth factor beta-2; |
Gene ID | 7042 |
mRNA Refseq | NM_001135599 |
Protein Refseq | NP_001129071 |
MIM | 190220 |
Uniprot ID | P61812 |
Chromosome Location | 1q41 |
Pathway | ATF-2 transcription factor network, organism-specific biosystem; Amoebiasis, organism-specific biosystem; Amoebiasis, conserved biosystem; Cell cycle, organism-specific biosystem; Cell cycle, conserved biosystem; |
Function | beta-amyloid binding; cytokine activity; growth factor activity; protein binding; contributes_to protein binding; |
◆ Recombinant Proteins | ||
TGFB2-1053C | Recombinant Canine TGFB2 protein, His-tagged | +Inquiry |
TGFB2-4687R | Recombinant Rhesus monkey TGFB2 Protein, His-tagged | +Inquiry |
TGFB2-9161M | Recombinant Mouse TGFB2 Protein, His (Fc)-Avi-tagged | +Inquiry |
TGFB2-5695R | Recombinant Rat TGFB2 Protein, His (Fc)-Avi-tagged | +Inquiry |
TGFB2-1253C | Recombinant Chicken TGFB2 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TGFB2-1119HCL | Recombinant Human TGFB2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TGFB2 Products
Required fields are marked with *
My Review for All TGFB2 Products
Required fields are marked with *
0
Inquiry Basket