Recombinant Human TRAM1 protein, GST-tagged

• Cat.No.: TRAM1-3760H
• Product Overview: Recombinant Human TRAM1 protein(310-374 aa), fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 310-374 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
• AA Sequence: FMMWKFINFQLRRWREHSAFQAPAVKKKPTVTKGRSSKKGTENGVNGTLTSNVADSPRNKKEKSS
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: TRAM1 translocation associated membrane protein 1 [ Homo sapiens ]
• Official Symbol: TRAM1
• Synonyms: TRAM1; translocation associated membrane protein 1; translocating chain-associated membrane protein 1; TRAM; TRAMP; translocation-associating membrane protein 1; translocating chain-associating membrane protein; PNAS8; PRO1292
• Gene ID: 23471
• mRNA Refseq: NM_014294
• Protein Refseq: NP_055109
• MIM: 605190
• UniProt ID: Q15629