Recombinant Human TRAF6 protein, GST-tagged

Cat.No. : TRAF6-31603TH
Product Overview : Recombinant Human TRAF6(413 a.a. - 522 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 413-522 a.a.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 37.84 kDa
AA Sequence : TMQGEYDSHLPWPFQGTIRLTILDQSEAPVRQNHEEIMDAKPELLAFQRPTIPRNPKGFGYVTFMHLEALRQRTF IKDDTLLVRCEVSTRFDMGSLRREGFQPRSTDAGV
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name TRAF6 TNF receptor-associated factor 6, E3 ubiquitin protein ligase [ Homo sapiens ]
Official Symbol TRAF6
Synonyms TRAF6; TNF receptor-associated factor 6, E3 ubiquitin protein ligase; TNF receptor associated factor 6; TNF receptor-associated factor 6; RNF85; RING finger protein 85; interleukin-1 signal transducer; E3 ubiquitin-protein ligase TRAF6; MGC:3310;
Gene ID 7189
mRNA Refseq NM_004620
Protein Refseq NP_004611
MIM 602355
UniProt ID Q9Y4K3
Chromosome Location 11p12
Pathway Activated TLR4 signalling, organism-specific biosystem; Adaptive Immune System, organism-specific biosystem; BCR signaling pathway, organism-specific biosystem; CD40/CD40L signaling, organism-specific biosystem; Canonical NF-kappaB pathway, organism-specific biosystem; Cell death signalling via NRAGE, NRIF and NADE, organism-specific biosystem; Chagas disease (American trypanosomiasis), organism-specific biosystem;
Function histone deacetylase binding; ligase activity; metal ion binding; mitogen-activated protein kinase kinase kinase binding; protein N-terminus binding; protein binding; protein kinase B binding; protein kinase binding; ubiquitin-protein ligase activity; ubiquitin-protein ligase activity; ubiquitin-protein ligase activity; zinc ion binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All TRAF6 Products

Required fields are marked with *

My Review for All TRAF6 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon