Recombinant Human TRAF3IP2 protein, His-tagged

• Cat.No.: TRAF3IP2-2918H
• Product Overview: Recombinant Human TRAF3IP2 protein(1-350 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-350 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: MNRSIPVEVDESEPYPSQLLKPIPEYSPEEESEPPAPNIRNMAPNSLSAPTMLHNSSGDFSQAHSTLKLANHQRPVSRQVTCLRTQVLEDSEDSFCRRHPGLGKAFPSGCSAVSEPASESVVGALPAEHQFSFMEKRNQWLVSQLSAASPDTGHDSDKSDQSLPNASADSLGGSQEMVQRPQPHRNRAGLDLPTIDTGYDSQPQDVLGIRQLERPLPLTSVCYPQDLPRPLRSREFPQFEPQRYPACAQMLPPNLSPHAPWNYHYHCPGSPDHQVPYGHDYPRAAYQQVIQPALPGQPLPGASVRGLHPVQKVILNYPSPWDQEERPAQRDCSFPGLPRHQDQPHHQPPN
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: TRAF3IP2 TRAF3 interacting protein 2 [ Homo sapiens ]
• Official Symbol: TRAF3IP2
• Synonyms: TRAF3IP2; TRAF3 interacting protein 2; C6orf2, C6orf4, C6orf5, C6orf6, chromosome 6 open reading frame 2 , chromosome 6 open reading frame 5; adapter protein CIKS; ACT1; CIKS; DKFZP586G0522; NFkB-activating protein ACT1; connection to IKK and SAPK/JNK; nuclear factor NF-kappa-B activator 1; C6orf2; C6orf4; C6orf5; C6orf6; PSORS13; MGC3581; DKFZp586G0522
• Gene ID: 10758
• mRNA Refseq: NM_001164281
• Protein Refseq: NP_001157753
• MIM: 607043
• UniProt ID: O43734