Recombinant Human TRAF1, His-tagged

Description :	The protein encoded by this gene is a member of the TNF receptor (TNFR) associated factor (TRAF) protein family. TRAF proteins associate with, and mediate the signal transduction from various receptors of the TNFR superfamily. This protein and TRAF2 form a heterodimeric complex, which is required for TNF-alpha-mediated activation of MAPK8/JNK and NF-kappaB. The protein complex formed by this protein and TRAF2 also interacts with inhibitor-of-apoptosis proteins (IAPs), and thus mediates the anti-apoptotic signals from TNF receptors. The expression of this protein can be induced by Epstein-Barr virus (EBV). EBV infection membrane protein 1 (LMP1) is found to interact with this and other TRAF proteins; this interaction is thought to link LMP1-mediated B lymphocyte transformation to the signal transduction from TNFR family receptors. Three transcript variants encoding two different isoforms have been found for this gene.
Protein length :	151 amino acids
Conjugation :	HIS
Molecular Weight :	19.500kDa
Source :	E. coli
Form :	Liquid
Purity :	>95% by SDS-PAGE
Storage buffer :	pH: 8.00Constituents:0.32% Tris HCl, 0.58% Sodium chloride, 0.02% DTT, 20% Glycerol
Storage :	Please see Notes section
Sequences of amino acids :	MGSSHHHHHHSSGLVPRGSHMDGTFLWKITNVTRRCHESA CGRTVSLFSPAFYTAKYGYKLCLRLYLNGDGTGKRTHLSL FIVIMRGEYDALLPWPFRNKVTFMLLDQNNREHAIDAFRP DLSSASFQRPQSETNVASGCPLFFPLSKLQSPKHAYVKDD TMFLKCIVETST
Sequence Similarities :	Contains 1 MATH domain.

Gene Name	TRAF1 TNF receptor-associated factor 1 [ Homo sapiens ]
Official Symbol	TRAF1
Synonyms	TRAF1; TNF receptor-associated factor 1; EBI6;
Gene ID	7185
mRNA Refseq	NM_005658
Protein Refseq	NP_005649
MIM	601711
Uniprot ID	Q13077
Chromosome Location	9q33-q34
Pathway	Apoptosis, organism-specific biosystem; CD40/CD40L signaling, organism-specific biosystem; HIV-1 Nef: Negative effector of Fas and TNF-alpha, organism-specific biosystem; Herpes simplex infection, organism-specific biosystem; Herpes simplex infection, conserved biosystem;
Function	protein binding; zinc ion binding;

RRM2-705H	Recombinant Full Length Human Ribonucleotide Reductase M2, His-tagged	+Inquiry
FIS1-2477H	Recombinant Human FIS1, His-tagged	+Inquiry
RAB27A-2479H	Recombinant Human RAB27A, His-tagged	+Inquiry
RAB11A-2480H	Recombinant Human RAB11A, Member RAS Oncogene Family, His-tagged	+Inquiry
ADK-2481H	Recombinant Human Adenosine Kinase, His-tagged	+Inquiry