Recombinant Human TRA2B protein, His-SUMO-tagged

• Cat.No.: TRA2B-3488H
• Product Overview: Recombinant Human TRA2B protein(P62995)(111-201aa), fused to N-terminal His-SUMO tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His&SUMO
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 26.5 kDa
• Protein length: 111-201aa
• AA Sequence: RANPDPNCCLGVFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFENVDDAKEAKERANGMELDGRRIRVDFSITKRPHT
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: TRA2B transformer 2 beta homolog (Drosophila) [ Homo sapiens ]
• Official Symbol: TRA2B
• Synonyms: TRA2B; transformer 2 beta homolog (Drosophila); SFRS10, splicing factor, arginine/serine rich 10 (transformer 2 homolog, Drosophila); transformer-2 protein homolog beta; Htra2 beta; TRA-2 beta; transformer-2 protein homolog B; splicing factor, arginine/serine-rich 10 (transformer 2 homolog, Drosophila); SFRS10; SRFS10; TRAN2B; TRA2-BETA; Htra2-beta; DKFZp686F18120
• Gene ID: 6434
• mRNA Refseq: NM_001243879
• Protein Refseq: NP_001230808
• MIM: 602719
• UniProt ID: P62995