Recombinant Human TPTE protein(11-80 aa), C-His-tagged

• Cat.No.: TPTE-2791H
• Product Overview: Recombinant Human TPTE protein(P56180)(11-80 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His
• Protein length: 11-80 aa
• Form: 0.15 M Phosphate buffered saline
• AASequence: AGVIIELGPNDSPQTSEFKGATEEAPAKESPHTSEFKGAARVSPISESVLARLSKFEVEDAENVASYDSK
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: TPTE transmembrane phosphatase with tensin homology [ Homo sapiens ]
• Official Symbol: TPTE
• Synonyms: TPTE; transmembrane phosphatase with tensin homology; putative tyrosine-protein phosphatase TPTE; cancer/testis antigen 44; CT44; PTEN related tyrosine phosphatase; PTEN2; tumor antigen BJ-HCC-5; PTEN-related tyrosine phosphatase; tensin, putative protein-tyrosine phosphatase
• Gene ID: 7179
• mRNA Refseq: NM_199259
• Protein Refseq: NP_954868
• MIM: 604336
• UniProt ID: P56180