Recombinant Human TPTE protein(11-80 aa), C-His-tagged

Cat.No. : TPTE-2791H
Product Overview : Recombinant Human TPTE protein(P56180)(11-80 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 11-80 aa
Form : 0.15 M Phosphate buffered saline
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : AGVIIELGPNDSPQTSEFKGATEEAPAKESPHTSEFKGAARVSPISESVLARLSKFEVEDAENVASYDSK
Gene Name TPTE transmembrane phosphatase with tensin homology [ Homo sapiens ]
Official Symbol TPTE
Synonyms TPTE; transmembrane phosphatase with tensin homology; putative tyrosine-protein phosphatase TPTE; cancer/testis antigen 44; CT44; PTEN related tyrosine phosphatase; PTEN2; tumor antigen BJ-HCC-5; PTEN-related tyrosine phosphatase; tensin, putative protein-tyrosine phosphatase;
Gene ID 7179
mRNA Refseq NM_199259
Protein Refseq NP_954868
MIM 604336
UniProt ID P56180

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All TPTE Products

Required fields are marked with *

My Review for All TPTE Products

Required fields are marked with *

0

Inquiry Basket

cartIcon