Recombinant Human TPRKB Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : TPRKB-4205H
Product Overview : TPRKB MS Standard C13 and N15-labeled recombinant protein (NP_057142) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. The complex is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37. TPRKB acts as an allosteric effector that regulates the t(6)A activity of the complex. TPRKB is not required for tRNA modification.
Molecular Mass : 19.7 kDa
AA Sequence : MQLTHQLDLFPECRVTLLLFKDVKNAGDLRRKAMEGTIDGSLINPTVIVDPFQILVAANKAVHLYKLGKMKTRTLSTEIIFNLSPNNNISEALKKFGISANDTSILIVYIEEGEKQINQEYLISQVEGHQVSLKNLPEIMNITEVKKIYKLSSQEESIGTLLDAIICRMSTKDVLTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name TPRKB TP53RK binding protein [ Homo sapiens (human) ]
Official Symbol TPRKB
Synonyms TPRKB; TP53RK binding protein; TP53RK-binding protein; CGI 121; PRPK-binding protein; PRPK (p53-related protein kinase)-binding protein; CGI-121;
Gene ID 51002
mRNA Refseq NM_016058
Protein Refseq NP_057142
MIM 608680
UniProt ID Q9Y3C4

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All TPRKB Products

Required fields are marked with *

My Review for All TPRKB Products

Required fields are marked with *

0

Inquiry Basket

cartIcon