Recombinant Human TPPP2 protein, GST-tagged
| Cat.No. : | TPPP2-3374H |
| Product Overview : | Recombinant Human TPPP2 protein(1-170 aa), fused with N-terminal GST tag, was expressed in E.coli. |
| Availability | December 15, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-170 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
| AASequence : | MASEAEKTFHRFAAFGESSSSGTEMNNKNFSKLCKDCGIMDGKTVTSTDVDIVFSKVKAKNARTITFQQFKEAVKELGQKRFKGKSPDEVLENIYGLMEGKDPATTGATKATTVGAVDRLTDTSKYTGTHKELFDESGKGKGIAGREEMTDNTGYVSGYKGSGTYDKKTK |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | TPPP2 tubulin polymerization-promoting protein family member 2 [ Homo sapiens ] |
| Official Symbol | TPPP2 |
| Synonyms | P18; C14orf8; p25beta |
| Gene ID | 122664 |
| mRNA Refseq | NM_173846.4 |
| Protein Refseq | NP_776245.2 |
| UniProt ID | P59282 |
| ◆ Recombinant Proteins | ||
| TPPP2-2404H | Recombinant Human TPPP2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| TPPP2-4735R | Recombinant Rhesus Macaque TPPP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| TPPP2-4921R | Recombinant Rhesus monkey TPPP2 Protein, His-tagged | +Inquiry |
| Tppp2-6606M | Recombinant Mouse Tppp2 Protein, Myc/DDK-tagged | +Inquiry |
| TPPP2-17265M | Recombinant Mouse TPPP2 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TPPP2-838HCL | Recombinant Human TPPP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TPPP2 Products
Required fields are marked with *
My Review for All TPPP2 Products
Required fields are marked with *
