Recombinant Human TPM4 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | TPM4-4820H |
Product Overview : | TPM4 MS Standard C13 and N15-labeled recombinant protein (NP_001138632) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a member of the tropomyosin family of actin-binding proteins involved in the contractile system of striated and smooth muscles and the cytoskeleton of non-muscle cells. Tropomyosins are dimers of coiled-coil proteins that polymerize end-to-end along the major groove in most actin filaments. They provide stability to the filaments and regulate access of other actin-binding proteins. In muscle cells, they regulate muscle contraction by controlling the binding of myosin heads to the actin filament. Multiple transcript variants encoding different isoforms have been found for this gene. |
Molecular Mass : | 32.5 kDa |
AA Sequence : | MEAIKKKMQMLKLDKENAIDRAEQAEADKKAAEDKCKQVEEELTHLQKKLKGTEDELDKYSEDLKDAQEKLELTEKKASDAEGDVAALNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRAMKDEEKMEIQEMQLKEAKHIAEEADRKYEEVARKLVILEGELERAEERAEVSELKCGDLEEELKNVTNNLKSLEAASEKYSEKEDKYEEEIKLLSDKLKEAETRAEFAERTVAKLEKTIDDLEEKLAQAKEENVGLHQTLDQTLNELNCITRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | TPM4 tropomyosin 4 [ Homo sapiens (human) ] |
Official Symbol | TPM4 |
Synonyms | TPM4; tropomyosin 4; tropomyosin alpha-4 chain; TM30p1; tropomyosin-4; |
Gene ID | 7171 |
mRNA Refseq | NM_001145160 |
Protein Refseq | NP_001138632 |
MIM | 600317 |
UniProt ID | P67936 |
◆ Recombinant Proteins | ||
TPM4-6899H | Recombinant Human Tropomyosin 4, His-tagged | +Inquiry |
TPM4-4820H | Recombinant Human TPM4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
TPM4-17259M | Recombinant Mouse TPM4 Protein | +Inquiry |
Tpm4-6601M | Recombinant Mouse Tpm4 Protein, Myc/DDK-tagged | +Inquiry |
TPM4-6244R | Recombinant Rat TPM4 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TPM4-1036HCL | Recombinant Human TPM4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TPM4 Products
Required fields are marked with *
My Review for All TPM4 Products
Required fields are marked with *
0
Inquiry Basket