Recombinant Human TPH1 protein, His-tagged
Cat.No. : | TPH1-3367H |
Product Overview : | Recombinant Human TPH1 protein(64-123 aa), fused with N-terminal His tag, was expressed in E. coli. |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Source : | E. coli |
Species : | Human |
Tag : | N-His |
Protein length : | 64-123 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AASequence : | VDCDINREQLNDIFHLLKSHTNVLSVNLPDNFTLKEDGMETVPWFPKKISDLDHCANRVL |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
Gene Name | TPH1 tryptophan hydroxylase 1 [ Homo sapiens ] |
Official Symbol | TPH1 |
Synonyms | TPH1; tryptophan hydroxylase 1; TPH, TPRH, tryptophan hydroxylase (tryptophan 5 monooxygenase); tryptophan 5-hydroxylase 1; tryptophan 5 monooxygenase; L-tryptophan hydroxylase; tryptophan 5-monooxygenase 1; indoleacetic acid-5-hydroxylase; tryptophan hydroxylase (tryptophan 5-monooxygenase); TPRH; TRPH; MGC119994; |
Gene ID | 7166 |
mRNA Refseq | NM_004179 |
Protein Refseq | NP_004170 |
MIM | 191060 |
UniProt ID | P17752 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All ABHD1 Products
Required fields are marked with *
My Review for All ABHD1 Products
Required fields are marked with *
0
Inquiry Basket