Recombinant Human TP53TG3 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: TP53TG3-5591H
• Product Overview: TP53TG3 MS Standard C13 and N15-labeled recombinant protein (NP_057296) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: TP53TG3 (TP53 Target 3) is a Protein Coding gene. Diseases associated with TP53TG3 include Wolf-Hirschhorn Syndrome. An important paralog of this gene is TP53TG3C.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 12.8 kDa
• AA Sequence: MRASPCISQPAASWHPRPSALRPTAGSGPDTRTPGTVEDGSAPCPAFRSPAVSPCGEEPCCFQISPAEETLELGRLVSPGNCDTLSPRAAGFYACHVRSLIPCRSTKGRWPLTASAAGLSSFSGTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: TP53TG3 TP53 target 3 [ Homo sapiens (human) ]
• Official Symbol: TP53TG3
• Synonyms: TP53TG3; TP53 target 3; TP53-target gene 3 protein; p53 target gene 3; P53TG3; TP53TG3A; TP53-inducible gene 3 protein; TP53TG3B; TP53TG3C; TP53TG3D
• Gene ID: 24150
• mRNA Refseq: NM_016212
• Protein Refseq: NP_057296
• MIM: 617482
• UniProt ID: Q9ULZ0