Recombinant Human TP53TG3 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : TP53TG3-5591H
Product Overview : TP53TG3 MS Standard C13 and N15-labeled recombinant protein (NP_057296) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : TP53TG3 (TP53 Target 3) is a Protein Coding gene. Diseases associated with TP53TG3 include Wolf-Hirschhorn Syndrome. An important paralog of this gene is TP53TG3C.
Molecular Mass : 12.8 kDa
AA Sequence : MRASPCISQPAASWHPRPSALRPTAGSGPDTRTPGTVEDGSAPCPAFRSPAVSPCGEEPCCFQISPAEETLELGRLVSPGNCDTLSPRAAGFYACHVRSLIPCRSTKGRWPLTASAAGLSSFSGTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name TP53TG3 TP53 target 3 [ Homo sapiens (human) ]
Official Symbol TP53TG3
Synonyms TP53TG3; TP53 target 3; TP53-target gene 3 protein; p53 target gene 3; P53TG3; TP53TG3A; TP53-inducible gene 3 protein; TP53TG3B; TP53TG3C; TP53TG3D;
Gene ID 24150
mRNA Refseq NM_016212
Protein Refseq NP_057296
MIM 617482
UniProt ID Q9ULZ0

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All TP53TG3 Products

Required fields are marked with *

My Review for All TP53TG3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon