Recombinant Human TP53TG3 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | TP53TG3-5591H |
Product Overview : | TP53TG3 MS Standard C13 and N15-labeled recombinant protein (NP_057296) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | TP53TG3 (TP53 Target 3) is a Protein Coding gene. Diseases associated with TP53TG3 include Wolf-Hirschhorn Syndrome. An important paralog of this gene is TP53TG3C. |
Molecular Mass : | 12.8 kDa |
AA Sequence : | MRASPCISQPAASWHPRPSALRPTAGSGPDTRTPGTVEDGSAPCPAFRSPAVSPCGEEPCCFQISPAEETLELGRLVSPGNCDTLSPRAAGFYACHVRSLIPCRSTKGRWPLTASAAGLSSFSGTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | TP53TG3 TP53 target 3 [ Homo sapiens (human) ] |
Official Symbol | TP53TG3 |
Synonyms | TP53TG3; TP53 target 3; TP53-target gene 3 protein; p53 target gene 3; P53TG3; TP53TG3A; TP53-inducible gene 3 protein; TP53TG3B; TP53TG3C; TP53TG3D; |
Gene ID | 24150 |
mRNA Refseq | NM_016212 |
Protein Refseq | NP_057296 |
MIM | 617482 |
UniProt ID | Q9ULZ0 |
◆ Recombinant Proteins | ||
TP53TG3-5591H | Recombinant Human TP53TG3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
TP53TG3-2301H | Recombinant Human TP53TG3 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TP53TG3-855HCL | Recombinant Human TP53TG3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TP53TG3 Products
Required fields are marked with *
My Review for All TP53TG3 Products
Required fields are marked with *
0
Inquiry Basket