Recombinant Human TP53BP2 protein, His-tagged
Cat.No. : | TP53BP2-2678H |
Product Overview : | Recombinant Human TP53BP2 protein(273-519 aa), fused to His tag, was expressed in E. coli. |
Availability | March 10, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 273-519 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | SSTMPRMPSRPELLVKPALPDGSLVIQASEGPMKIQTLPNMRSGAASQTKGSKIHPVGPDWSPSNADLFPSQGSASVPQSTGNALDQVDDGEVPLREKEKKVRPFSMFDAVDQSNAPPSFGTLRKNQSSEDILRDAQVANKNVAKVPPPVPTKPKQINLPYFGQTNQPPSDIKPDGSSQQLSTVVPSMGTKPKPAGQQPRVLLSPSIPSVGQDQTLSPGSKQESPPAAAVRPFTPQPSKDTLLPPFR |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | TP53BP2 tumor protein p53 binding protein, 2 [ Homo sapiens ] |
Official Symbol | TP53BP2 |
Synonyms | TP53BP2; tumor protein p53 binding protein, 2; apoptosis-stimulating of p53 protein 2; 53BP2; ASPP2; PPP1R13A; BCL2-binding protein; renal carcinoma antigen NY-REN-51; tumor suppressor p53-binding protein 2; apoptosis-stimulating protein of p53, 2; BBP; P53BP2; |
Gene ID | 7159 |
mRNA Refseq | NM_001031685 |
Protein Refseq | NP_001026855 |
MIM | 602143 |
UniProt ID | Q13625 |
◆ Recombinant Proteins | ||
TP53BP2-2678H | Recombinant Human TP53BP2 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TP53BP2 Products
Required fields are marked with *
My Review for All TP53BP2 Products
Required fields are marked with *
0
Inquiry Basket