Recombinant Human TP53 Protein, GST-tagged
Cat.No. : | TP53-30574H |
Product Overview : | Recombinant human TP53 protein with a GST tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Description : | This gene encodes a tumor suppressor protein containing transcriptional activation, DNA binding, and oligomerization domains. The encoded protein responds to diverse cellular stresses to regulate expression of target genes, thereby inducing cell cycle arrest, apoptosis, senescence, DNA repair, or changes in metabolism. Mutations in this gene are associated with a variety of human cancers, including hereditary cancers such as Li-Fraumeni syndrome. Alternative splicing of this gene and the use of alternate promoters result in multiple transcript variants and isoforms. Additional isoforms have also been shown to result from the use of alternate translation initiation codons from identical transcript variants. |
AA Sequence : | MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDGSTSLVPRGSEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGPDEAPRMPEAAPPVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELPPGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPGGSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD |
Purity : | >80 % as determined by SDS-PAGE |
Storage : | Long Term Storage at -20 to -80 centigrade. Avoid freeze/thaw cycles. |
Storage Buffer : | 50mM Tris-HCl, pH 7.5, 150mM NaCl, 0.25mM DTT, 0.1mM EGTA, 0.1mM EDTA, 0.1mM PMSF, 25% glycerol |
Gene Name | TP53 tumor protein p53 [ Homo sapiens (human) ] |
Official Symbol | TP53 |
Synonyms | TP53; tumor protein p53; P53; BCC7; LFS1; BMFS5; TRP53; cellular tumor antigen p53; antigen NY-CO-13; mutant tumor protein 53; p53 tumor suppressor; phosphoprotein p53; transformation-related protein 53; tumor protein 53; tumor supressor p53 |
Gene ID | 7157 |
mRNA Refseq | NM_000546 |
Protein Refseq | NP_000537 |
MIM | 191170 |
UniProt ID | P04637 |
◆ Recombinant Proteins | ||
TP53-3436H | Active Recombinant Human TP53, His-tagged | +Inquiry |
TP53-6230R | Recombinant Rat TP53 Protein | +Inquiry |
TP53-123HFL | Active Recombinant Full Length Human TP53 Protein, N-cMyc,GST-tagged | +Inquiry |
TP53-2235H | Recombinant Human TP53 Protein, His (Fc)-Avi-tagged | +Inquiry |
TP53-6492H | Recombinant Human TP53 Protein (Met1-Asp393, R175H), C-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TP53-860HCL | Recombinant Human TP53 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TP53 Products
Required fields are marked with *
My Review for All TP53 Products
Required fields are marked with *
0
Inquiry Basket