Recombinant Human TP53 protein(301-390 aa), C-His-tagged

• Cat.No.: TP53-2547H
• Product Overview: Recombinant Human TP53 protein(P04637)(301-390 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 301-390 aa
• Form: 0.15 M Phosphate buffered saline
• Molecular Mass: 12.5 kDa
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPGGSRAHSSHLKSKKGQSTSRHKKLMFKTEGP

Gene Information

• Gene Name: TP53 tumor protein p53 [ Homo sapiens ]
• Official Symbol: TP53
• Synonyms: TP53; tumor protein p53; cellular tumor antigen p53; LFS1; Li Fraumeni syndrome; p53; antigen NY-CO-13; mutant p53 protein; phosphoprotein p53; p53 tumor suppressor; truncated p53 protein; tumor suppressor TP53; transformation-related protein 53; P53; TRP53; FLJ92943
• Gene ID: 7157
• mRNA Refseq: NM_000546
• Protein Refseq: NP_000537
• MIM: 191170
• UniProt ID: P04637