Recombinant Human TOX4 protein, GST-tagged

• Cat.No.: TOX4-301548H
• Product Overview: Recombinant Human TOX4 (43-215 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: Ser43-Arg215
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: SLDSDPSLAVSDVVGHFDDLADPSSSQDGSFSAQYGVQTLDMPVGMTHGLMEQGGGLLSGGLTMDLDHSIGTQYSANPPVTIDVPMTDMTSGLMGHSQLTTIDQSELSSQLGLSLGGGTILPPAQSPEDRLSTTPSPTSSLHEDGVEDFRRQLPSQKTVVVEAGKKQKAPKKR
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: TOX4 TOX high mobility group box family member 4 [ Homo sapiens ]
• Official Symbol: TOX4
• Synonyms: TOX4; TOX high mobility group box family member 4; C14orf92, chromosome 14 open reading frame 92 , KIAA0737; LCP1; migration-inducing protein 7; epidermal Langerhans cell protein LCP1; MIG7; C14orf92; KIAA0737
• Gene ID: 9878
• mRNA Refseq: NM_014828
• Protein Refseq: NP_055643
• MIM: 614032
• UniProt ID: O94842