Recombinant Human TOMM40 protein, GST-tagged

• Cat.No.: TOMM40-3607H
• Product Overview: Recombinant Human TOMM40 protein(O96008)(1-361aa), fused to N-terminal GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-361aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 64.9 kDa
• AA Sequence: MGNVLAASSPPAGPPPPPAPALVGLPPPPPSPPGFTLPPLGGSLGAGTSTSRSSERTPGAATASASGAAEDGACGCLPNPGTFEECHRKCKELFPIQMEGVKLTVNKGLSNHFQVNHTVALSTIGESNYHFGVTYVGTKQLSPTEAFPVLVGDMDNSGSLNAQVIHQLGPGLRSKMAIQTQQSKFVNWQVDGEYRGSDFTAAVTLGNPDVLVGSGILVAHYLQSITPCLALGGELVYHRRPGEEGTVMSLAGKYTLNNWLATVTLGQAGMHATYYHKASDQLQVGVEFEASTRMQDTSVSFGYQLDLPKANLLFKGSVDSNWIVGATLEKKLPPLPLTLALGAFLNHRKNKFQCGFGLTIG
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: TOMM40 translocase of outer mitochondrial membrane 40 homolog (yeast) [ Homo sapiens ]
• Official Symbol: TOMM40
• Synonyms: TOMM40; translocase of outer mitochondrial membrane 40 homolog (yeast); mitochondrial import receptor subunit TOM40 homolog; C19orf1; D19S1177E; PER EC1; PEREC1; TOM40; p38.5; protein Haymaker; mitochondrial outer membrane protein; translocase of outer membrane 40 kDa subunit homolog; PER-EC1
• Gene ID: 10452
• mRNA Refseq: NM_001128916
• Protein Refseq: NP_001122388
• MIM: 608061
• UniProt ID: O96008