Recombinant Human TOMM22 Protein, GST-tagged

• Cat.No.: TOMM22-04H
• Product Overview: Human TOMM22 partial ORF ( NP_064628, 12 a.a. - 84 a.a.) recombinant protein with GST-tag at N-terminal was expressed in Wheat Germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this gene is an integral membrane protein of the mitochondrial outer membrane. The encoded protein interacts with TOMM20 and TOMM40, and forms a complex with several other proteins to import cytosolic preproteins into the mitochondrion.
• Molecular Mass: 33.77 kDa
• AA Sequence: EPQSPDELLPKGDAEKPEEELEEDDDEELDETLSERLWGLTEMFPERVRSAAGATFDLSLFVAQKMYRFSRAA
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: TOMM22 translocase of outer mitochondrial membrane 22 [ Homo sapiens (human) ]
• Official Symbol: TOMM22
• Synonyms: TOMM22; translocase of outer mitochondrial membrane 22; 1C9-2; TOM22; MST065; MSTP065; mitochondrial import receptor subunit TOM22 homolog; mitochondrial import receptor Tom22; translocase of outer membrane 22 kDa subunit homolog; translocase of outer mitochondrial membrane 22 homolog
• Gene ID: 56993
• mRNA Refseq: NM_020243
• Protein Refseq: NP_064628
• MIM: 607046
• UniProt ID: Q9NS69