Recombinant Human TNNC2 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: TNNC2-2912H
• Product Overview: TNNC2 MS Standard C13 and N15-labeled recombinant protein (NP_003270) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: Troponin (Tn), a key protein complex in the regulation of striated muscle contraction, is composed of 3 subunits. The Tn-I subunit inhibits actomyosin ATPase, the Tn-T subunit binds tropomyosin and Tn-C, while the Tn-C subunit binds calcium and overcomes the inhibitory action of the troponin complex on actin filaments. The protein encoded by this gene is the Tn-C subunit.
• Molecular Mass: 18.1 kDa
• AA Sequence: MTDQQAEARSYLSEEMIAEFKAAFDMFDADGGGDISVKELGTVMRMLGQTPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMKEDAKGKSEEELAECFRIFDRNADGYIDPEELAEIFRASGEHVTDEEIESLMKDGDKNNDGRIDFDEFLKMMEGVQTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: TNNC2 troponin C2, fast skeletal type [ Homo sapiens (human) ]
• Official Symbol: TNNC2
• Synonyms: TNNC2; troponin C type 2 (fast); troponin C2, fast; troponin C, skeletal muscle
• Gene ID: 7125
• mRNA Refseq: NM_003279
• Protein Refseq: NP_003270
• MIM: 191039
• UniProt ID: P02585