Recombinant Human TNKS2 protein, GST-tagged

Cat.No. : TNKS2-3329H
Product Overview : Recombinant Human TNKS2(1068 a.a. - 1166 a.a.), fussed with GST at N-terminal, was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 1068 a.a. - 1166 a.a.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 36.63 kDa
AA Sequence : SNQYVYGIGGGTGCPVHKDRSCYICHRQLLFCRVTLGKSFLQFSAMKMAHSPPGHHSVTGRPSVNGLALAEYVIY RGEQAYPEYLITYQIMRPEGMVDG
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name TNKS2 tankyrase, TRF1-interacting ankyrin-related ADP-ribose polymerase 2 [ Homo sapiens ]
Official Symbol TNKS2
Synonyms TNKS2; tankyrase, TRF1-interacting ankyrin-related ADP-ribose polymerase 2; tankyrase-2; PARP 5b; PARP 5c; PARP5B; PARP5C; pART6; TANK2; TNKL; TNKS-2; tankyrase 2; tankyrase II; tankyrase-like protein; tankyrase-related protein; poly [ADP-ribose] polymerase 5B; TRF1-interacting ankyrin-related ADP-ribose polymerase 2; PARP-5b; PARP-5c;
Gene ID 80351
mRNA Refseq NM_025235
Protein Refseq NP_079511
MIM 607128
UniProt ID Q9H2K2
Chromosome Location 10q23.3
Function NAD+ ADP-ribosyltransferase activity; metal ion binding; protein binding; transferase activity, transferring glycosyl groups;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All TNKS2 Products

Required fields are marked with *

My Review for All TNKS2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon