Source :	Wheat Germ
Species :	Human
Tag :	GST
Form :	50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass :	36.63 kDa
Protein length :	1068 a.a. - 1166 a.a.
AA Sequence :	SNQYVYGIGGGTGCPVHKDRSCYICHRQLLFCRVTLGKSFLQFSAMKMAHSPPGHHSVTGRPSVNGLALAEYVIY RGEQAYPEYLITYQIMRPEGMVDG
Applications :	Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes :	Best use within three months from the date of receipt of this protein.
Storage :	Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Name	TNKS2 tankyrase, TRF1-interacting ankyrin-related ADP-ribose polymerase 2 [ Homo sapiens ]
Official Symbol	TNKS2
Synonyms	TNKS2; tankyrase, TRF1-interacting ankyrin-related ADP-ribose polymerase 2; tankyrase-2; PARP 5b; PARP 5c; PARP5B; PARP5C; pART6; TANK2; TNKL; TNKS-2; tankyrase 2; tankyrase II; tankyrase-like protein; tankyrase-related protein; poly [ADP-ribose] polymerase 5B; TRF1-interacting ankyrin-related ADP-ribose polymerase 2; PARP-5b; PARP-5c;
Gene ID	80351
mRNA Refseq	NM_025235
Protein Refseq	NP_079511
MIM	607128
UniProt ID	Q9H2K2
Chromosome Location	10q23.3
Function	NAD+ ADP-ribosyltransferase activity; metal ion binding; protein binding; transferase activity, transferring glycosyl groups;