Recombinant Human TNIP3 protein, GST-tagged

• Cat.No.: TNIP3-301379H
• Product Overview: Recombinant Human TNIP3 (236-325 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: GST
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Protein length: Gln236-Pro325
• AA Sequence: QSQLNRLNSQIKACQMEKEKLEKQLKQMYCPPCNCGLVFHLQDPWVPTGPGAVQKQREHPPDYQWYALDQLPPDVQHKANGLSSVKKVHP
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: TNIP3 TNFAIP3 interacting protein 3 [ Homo sapiens ]
• Official Symbol: TNIP3
• Synonyms: TNIP3; TNFAIP3 interacting protein 3; TNFAIP3-interacting protein 3; ABIN 3; FLJ21162; LIND; TNIP3 beta; ABIN-3 beta; Listeria induced; listeria-induced gene protein; TNFAIP3-interacting protein 3 beta; A20-binding inhibitor of NF-kappa-B activation 3; ABIN-3
• Gene ID: 79931
• mRNA Refseq: NM_001128843
• Protein Refseq: NP_001122315
• MIM: 608019
• UniProt ID: Q96KP6