Recombinant Human TNFSF9 Protein, His-tagged
Cat.No. : | TNFSF9-876H |
Product Overview : | Recombinant Human TNFSF9 fused with His tag at C-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This transmembrane cytokine is a bidirectional signal transducer that acts as a ligand for TNFRSF9/4-1BB, which is a costimulatory receptor molecule in T lymphocytes. This cytokine and its receptor are involved in the antigen presentation process and in the generation of cytotoxic T cells. The receptor TNFRSF9/4-1BB is absent from resting T lymphocytes but rapidly expressed upon antigenic stimulation. The ligand encoded by this gene, TNFSF9/4-1BBL, has been shown to reactivate anergic T lymphocytes in addition to promoting T lymphocyte proliferation. This cytokine has also been shown to be required for the optimal CD8 responses in CD8 T cells. This cytokine is expressed in carcinoma cell lines, and is thought to be involved in T cell-tumor cell interaction. |
Form : | Lyophilized from a 0.2 µM filtered solution of PBS, pH 7.4 |
Molecular Mass : | 20.6kD |
AA Sequence : | MREGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSELEHHHHHH* |
Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
Concentration : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Gene Name | TNFSF9 tumor necrosis factor (ligand) superfamily, member 9 [ Homo sapiens ] |
Official Symbol | TNFSF9 |
Synonyms | TNFSF9; tumor necrosis factor (ligand) superfamily, member 9; tumor necrosis factor ligand superfamily member 9; 4 1BB L; homolog of mouse 4 1BB L; receptor 4 1BB ligand; 4-1BBL; 4-1BB ligand; receptor 4-1BB ligand; homolog of mouse 4-1BB-L; CD137L; 4-1BB-L; |
Gene ID | 8744 |
mRNA Refseq | NM_003811 |
Protein Refseq | NP_003802 |
MIM | 606182 |
UniProt ID | P41273 |
◆ Recombinant Proteins | ||
TNFSF9-31579TH | Recombinant Human TNFSF9, His-tagged | +Inquiry |
TNFSF9-5902H | Recombinant Human TNFSF9 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
TNFSF9-155H | Recombinant Human TNFSF9 protein | +Inquiry |
Tnfsf9-7446RAF488 | Recombinant Rat Tnfsf9 Protein, His-tagged, Alexa Fluor 488 conjugated | +Inquiry |
TNFSF9-5242H | Recombinant Human TNFSF9 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNFSF9-2810MCL | Recombinant Mouse TNFSF9 cell lysate | +Inquiry |
TNFSF9-1445RCL | Recombinant Rat TNFSF9 cell lysate | +Inquiry |
TNFSF9-1444RCL | Recombinant Rat TNFSF9 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TNFSF9 Products
Required fields are marked with *
My Review for All TNFSF9 Products
Required fields are marked with *
0
Inquiry Basket