Recombinant Human TNFSF9 Protein, Fc-tagged
Cat.No. : | TNFSF9-584H |
Product Overview : | Recombinant human TNFSF9 protein with Fc tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | Fc |
Protein Length : | 254 |
Description : | The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This transmembrane cytokine is a bidirectional signal transducer that acts as a ligand for TNFRSF9/4-1BB, which is a costimulatory receptor molecule in T lymphocytes. This cytokine and its receptor are involved in the antigen presentation process and in the generation of cytotoxic T cells. The receptor TNFRSF9/4-1BB is absent from resting T lymphocytes but rapidly expressed upon antigenic stimulation. The ligand encoded by this gene, TNFSF9/4-1BBL, has been shown to reactivate anergic T lymphocytes in addition to promoting T lymphocyte proliferation. This cytokine has also been shown to be required for the optimal CD8 responses in CD8 T cells. This cytokine is expressed in carcinoma cell lines, and is thought to be involved in T cell-tumor cell interaction. |
Form : | Lyophilized |
Molecular Mass : | 47.4 kDa |
AA Sequence : | MEYASDASLDPEAPWPPAPRARACRVLPWALVAGLLLLLLLAAACAVFLACPWAVSGARASPGSAASPRLREGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE |
Purity : | > 98% |
Applications : | WB; ELISA; FACS; FC |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | At -20 centigrade. |
Concentration : | 1 mg/mL |
Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Gene Name | TNFSF9 tumor necrosis factor (ligand) superfamily, member 9 [ Homo sapiens (human) ] |
Official Symbol | TNFSF9 |
Synonyms | TNFSF9; tumor necrosis factor (ligand) superfamily, member 9; tumor necrosis factor ligand superfamily member 9; 4 1BB L; homolog of mouse 4 1BB L; receptor 4 1BB ligand; 4-1BBL; 4-1BB ligand; receptor 4-1BB ligand; homolog of mouse 4-1BB-L; CD137L; 4-1BB-L; |
Gene ID | 8744 |
mRNA Refseq | NM_003811 |
Protein Refseq | NP_003802 |
MIM | 606182 |
UniProt ID | P41273 |
◆ Recombinant Proteins | ||
TNFSF9-286H | Recombinant Human TNFSF9, StrepII-tagged | +Inquiry |
TNFSF9-0249H | Recombinant Human TNFSF9 Protein (Arg71-Glu254), N-Fc-tagged | +Inquiry |
Tnfsf9-324M | Recombinant Active Mouse TNFSF9 Protein, His-tagged(C-ter) | +Inquiry |
TNFSF9-2842R | Active Recombinant Rat TNFSF9 protein, His-Flag-tagged | +Inquiry |
RFL9702HF | Recombinant Full Length Human Tumor Necrosis Factor Ligand Superfamily Member 9(Tnfsf9) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNFSF9-1444RCL | Recombinant Rat TNFSF9 cell lysate | +Inquiry |
TNFSF9-2810MCL | Recombinant Mouse TNFSF9 cell lysate | +Inquiry |
TNFSF9-1445RCL | Recombinant Rat TNFSF9 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TNFSF9 Products
Required fields are marked with *
My Review for All TNFSF9 Products
Required fields are marked with *
0
Inquiry Basket